PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g60106.1.p
Common NameBRADI_1g60106, LOC100821467
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 267aa    MW: 29518.1 Da    PI: 6.3469
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g60106.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.72.4e-171461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg+WT+ Ede+lv +++++G g W + +++ g++R++k+c++rw++yl
  Bradi1g60106.1.p 14 RGAWTAMEDEILVSYINRHGEGKWGSLPKRAGLKRCGKSCRLRWLNYL 61
                      89********************************************97 PP

2Myb_DNA-binding521.6e-1667111147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg+ + +E+el+v+++++lG++ W++Ia +++ gRt++++k++w++ 
  Bradi1g60106.1.p  67 RGNISDDEEELIVRLHRLLGNR-WSLIAGRLP-GRTDNEIKNYWNTT 111
                       7899******************.*********.************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-22564IPR009057Homeodomain-like
PROSITE profilePS5129415.082961IPR017930Myb domain
SuperFamilySSF466891.64E-2712108IPR009057Homeodomain-like
SMARTSM007172.4E-131363IPR001005SANT/Myb domain
PfamPF002492.7E-151461IPR001005SANT/Myb domain
CDDcd001671.02E-101661No hitNo description
PROSITE profilePS5129424.68962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.4E-2465116IPR009057Homeodomain-like
SMARTSM007171.6E-1566114IPR001005SANT/Myb domain
PfamPF002492.8E-1467111IPR001005SANT/Myb domain
CDDcd001676.42E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006633Biological Processfatty acid biosynthetic process
GO:0006970Biological Processresponse to osmotic stress
GO:0010023Biological Processproanthocyanidin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MGRKPCCSKE GLNRGAWTAM EDEILVSYIN RHGEGKWGSL PKRAGLKRCG KSCRLRWLNY  60
LRPGIKRGNI SDDEEELIVR LHRLLGNRWS LIAGRLPGRT DNEIKNYWNT TLSKRMLLTA  120
RGTNQQQQQA STPKPPHSSS VDAPPDHPDT SSSPIRTKAT RCTAMLPAHH DPIADQVVQE  180
TTTTHIEQQQ RGLDGDEDLS IELDFEGIEL GFLLSPWRVS ADGDRHELGD CGTHEADLEE  240
LLGLGPDGAQ SHGGVPSLGD LELPWL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-261211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1914592e-53AB191459.1 Triticum aestivum Tamyb10-B1 gene, complete cds.
GenBankAB5997222e-53AB599722.1 Triticum aestivum Tamyb10-B1 gene for myb-related protein, complete cds.
GenBankHE9967762e-53HE996776.1 Triticum aestivum cv. Arina SNP, chromosome 3B, clone Taes_arina_ctg_66711.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003561552.10.0PREDICTED: transcription repressor MYB6-like
TrEMBLA0A0Q3HEZ40.0A0A0Q3HEZ4_BRADI; Uncharacterized protein
STRINGSi038905m2e-85(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.11e-61myb domain protein 5